Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00005992001
Length(AA) : 976
Localization : scaffold_22
Number of EST contigs matching the gene: 3
Number of ESTs : 6
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: DNA ligase (Polydeoxyribonucleotide synthase
Specie: [ATP])
Accession: ref|XP_001218498.1| Score: 2140 E_value: 0.0
KEGG Definition: hypothetical protein
Accession: fgr:FG05453.1 Score: 2136 E_value: 0.0
KOG Definition: ATP-dependent DNA ligase I
Classification: [Replication, recombination and repair].
Kog Number: KOG0967 Score: 2023 E_value: 0.0
PFAM Definition: DNA_ligase_A_M, ATP dependent DNA ligase domain. This domain belongs to a more diverse superfamily, including pfam01331 and pfam01653..
Pfam Number: pfam01068 Score: 508 E_value: 1e-51
Swissprot: P12000|DNLI_SCHPO
Gene Ontology:
GO:0005739 = Cellular component: mitochondrion
GO:0005634 = Cellular component: nucleus
GO:0005657 = Cellular component: replication fork
GO:0003910 = Molecular function: DNA ligase (ATP) activity
GO:0005515 = Molecular function: protein binding
GO:0043137 = Biological process: DNA replication
removal of RNA primer
GO:0000723 = Biological process: telomere maintenance

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.084NO0.318NO0.108NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.6950.0290.394M423

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00946First60=0.00661PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00005992001
MSSSKKQTTLGYVKSQTTLGRFFSLPAGTNPATPIQSKLKTISKPGKAAD
TDDVASPKVRKTSARGQARKKPTIPEDDGSDGGAGYTKAGVSFSETEMSD
ASEPAIGSSKQKALGNSSTKRERPAARKCGIKPSNIKKETETSEDEAPPS
KRSKSAPTTKPLKKDCDESELSDEDIAPRKRLPIINSPKATAKKRKGKVV
GKAVDVNTPVSPSGTTKGARSSPISSPVVSPQESGESEPPLPESPSSTPK
ISKSKSGSKAKVAKKSPSDKRSKKRGAASDTEAVDKPESSATHKALDSDS
GTEKPSLAPAAGREMIKKLSKSVPPAYPDWVAGEPTPYAALVTTFNLLES
TTKRLEKISHTSRFLRQVLQLSPDELLLVIHLMINKLAADFEGVEMGIGE
SLLMKAIGESCGRSLERIREDQRECGDLGLVAMKSRNNQKTLFAPRPLTI
AVVHKGLLGIAKTKGEGGQGRKVSAIRKLLAAAKGDEAKFLIRGLEGKLR
LGLAERTVLVSLSSAMITHEQELVGKTPTTAMLDQSELNLRSVYSELPSY
EIIIPAMREHGIMDIKKYCKLQPGVPVKPMLAKPTKAISEVLDRFENKRF
TCEYKYDGERAQIHYVSPKSSIEYPPATLSGEPIKNLAKVFSRNSEDLSG
KYPDILAAMNEWVRPEVESFVLDCEAVGWDETNNRLLPFQMLQTRKKKDV
ALEDVKIRVCVHAFDLLFLNGKPVVRESLDDRRKLMHKTFIEVPNQFVFA
RYMDSSHLEEIRLFLDQSVKDSCEGLMVKMMDGPESFYEPSQRSRNWLKI
KKDYIDELGDSLDLVVIGAYWGRGKRTSVYGSFLLACYNPGTQNYESLCN
IGTGFTEAELEEFYGTLHPLEIDRAKPFYDHPSGNAGKPDVWFEPKVLWE
VKAADLTLSPRYKAAAGLAGHPDKGVSLRFPRFIGPRTDKTGEDATSSSQ
IAEMYLRQDQVAHKTGAKGVDDDFEY

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7036 hypothetical protein CHGG_05723 [Chaetomium globosum CBS 148.51]2e-56
SY0AAC3YF03FM1 hypothetical protein CHGG_05723 [Chaetomium globosum CBS 148.51]3e-56
SY0AAD47YG06FM1 hypothetical protein MGG_06370 [Magnaporthe grisea 70-15]1e-44


Manual Annotation:

Please find below the necessary files for GSTUMT00005992001 annotation :

link to GSTUMT00005992001 Artemis file
link to scaffold_22 sequence file
link to scaffold_22ESTs