Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004737001
Length(AA) : 568
Localization : scaffold_15
Number of EST contigs matching the gene: 2
Number of ESTs : 10
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: alkaline phosphatase Pho8
Specie: [Aspergillus fumigatus Af293]
Accession: ref|XP_749446.1| Score: 1669 E_value: 0.0
KEGG Definition: alkaline phosphatase Pho8 [EC:3.1.3.1]; K01077 alkaline phosphatase
Accession: afm:AFUA_2G03110 Score: 1669 E_value: 0.0
KOG Definition: Alkaline phosphatase
Classification: [Inorganic ion transport and metabolism].
Kog Number: KOG4126 Score: 865 E_value: 3e-93
PFAM Definition: Alk_phosphatase, Alkaline phosphatase..
Pfam Number: pfam00245 Score: 918 E_value: 2e-99
Swissprot: P11491|PPB_YEAST
Gene Ontology:
GO:0000329 = Cellular component: membrane of vacuole with cell cycle-correlated morphology
GO:0004035 = Molecular function: alkaline phosphatase activity
GO:0005515 = Molecular function: protein binding
GO:0006470 = Biological process: protein amino acid dephosphorylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.154NO0.815NO0.145NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.3260.0790.499_50

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=22.4385First60=22.0819PredHel=1
Topology=(38-60)

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004737001
MSRRSSTERSAEEDAALLSGRPTNKQAERGKWDGWVKLGLGVWAMAATAG
IVVIAVLWVNNGSGLNSKFPPEGKRNIVFMVSDGMGPTSLALTRSYRQFS
DSLPWNHTLTLDKHFIGTSRTRSSSSLVTDSAAGATAFSCGMKSYNGAIS
VLPDGSPCGTVLEAAKKAGYMTGLVVTTRITDATPACFSAHVNLRGEEDR
IAEQQIGDYPLGRMVDLMLGGGRCHFLPNTADGSCRDDSRDLVSEAQKRF
GFSYVDDRKSFDGLKKGAVKLPLLGLFAPTDIPYDIDRKDEDYPSLEEMT
EVALKALEIATKNSDKGFFLMIEGSRIDHAGHGNDPAAQVHEVLAYDRAF
KRVSDWIAGSRYPGVVVSTSDHETGGLAAARQLHEEYPEYLWYPEVLANA
SSSSEYLAAQYARYEGPADQEEDYIRDTILIKGLGIYDASDDEIEAIKDH
KDDVASAWVLADVISRRAQVGWTTHGHSGVDVNIYGSTGTSKLKGNHENT
EVGEFLRDYLQVDVDAITKELKGVNRVDAPGLDKAGYEWMGRPLSELKEA
GFETDKLDCYHGQFRHKH

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig7061 hypothetical protein SNOG_00453 [Phaeosphaeria nodorum SN15]1e-147
SY0AAD51YH02FM1 alkaline phosphatase Pho8 [Aspergillus fumigatus Af293]1e-32


Manual Annotation:

Please find below the necessary files for GSTUMT00004737001 annotation :

link to GSTUMT00004737001 Artemis file
link to scaffold_15 sequence file
link to scaffold_15ESTs