Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004718001
Length(AA) : 449
Localization : scaffold_14
Number of EST contigs matching the gene: 2
Number of ESTs : 73
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein BC1G_09861
Specie: [Botryotinia fuckeliana B05.10]
Accession: ref|XP_001551694.1| Score: 1503 E_value: 1e-164
KEGG Definition: hypothetical protein
Accession: yli:YALI0F08415g Score: 1404 E_value: 1e-153
KOG Definition: Glutamate decarboxylase/sphingosine phosphate lyase
Classification: [Amino acid transport and metabolism].
Kog Number: KOG1383 Score: 836 E_value: 5e-90
PFAM Definition: Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain..
Pfam Number: pfam00282 Score: 472 E_value: 7e-48
Swissprot: Q04792|DCE_YEAST
Gene Ontology:
GO:0005737 = Cellular component: cytoplasm
GO:0004351 = Molecular function: glutamate decarboxylase activity
GO:0006538 = Biological process: glutamate catabolic process
GO:0006979 = Biological process: response to oxidative stress

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.028NO0.075NO0.025NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.1690.0270.886_20

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.15561First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004718001
MSLSKHVDPDELIASLPEHPSARQPHLHRRAIHHYTYGSRYSAGTPIPKF
EIPGQGTEAGSVHQLIKDELDLDGRPNLNLASFVNTYMETHADQLIMENI
AKNLADADEYPALMAIHSRCVSMVSNLWNIPKGQTAIGTATTGSSEAIHL
GGLAMKRRWQERRRANGKSTEKPNILMGANAQVALEKFARYFDVEPRIIP
VSEESHWCLDPSKIRDNLDENTIGIFVILGSTYTGHFEPVEEVSNILDKY
EEETGISIPIHVDGASGAMVAPFTGSGGKWGFELPRVHSINTSGHKYGLV
YAGLGWIIWRGEEYLPKELIFELHYLGGTEQSYTLNFSRPGAQVLAQYFN
FLHLGKEGYKTQAVGTPVLAISIVNEASTVEGVKEAVLSDDNPHVYNAGL
PVVAFRLSDEFKKEFPHVKQASVSTLLRAKGYIIPSMFGLRVISSVLLF

EST contigs matching with the Gene:

ContigBest BlastXE-value
Contig1957 hypothetical protein BC1G_09861 [Botryotinia fuckeliana B05.10]1e-137
Contig6043 hypothetical protein SS1G_05050 [Sclerotinia sclerotiorum 1980]0.0


Manual Annotation:

Please find below the necessary files for GSTUMT00004718001 annotation :

link to GSTUMT00004718001 Artemis file
link to scaffold_14 sequence file
link to scaffold_14ESTs