Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00004257001
Length(AA) : 493
Localization : scaffold_11
Number of EST contigs matching the gene: 1
Number of ESTs : 1
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein SS1G_10101
Specie: [Sclerotinia sclerotiorum 1980]
Accession: ref|XP_001588554.1| Score: 1563 E_value: 1e-171
KEGG Definition: hypothetical protein [EC:3.2.1.1]; K01176 alpha-amylase
Accession: mgr:MGG_03287 Score: 1465 E_value: 1e-160
KOG Definition: Alpha-amylase
Classification: [Carbohydrate transport and metabolism].
Kog Number: KOG0471 Score: 192 E_value: 2e-15
PFAM Definition: Alpha-amylase, Alpha amylase, catalytic domain. Alpha amylase is classified as family 13 of the glycosyl hydrolases. The structure is an 8 stranded alpha/beta barrel containing the active site, interrupted by a ~70 a.a. calcium-binding domain protruding between beta strand 3 and alpha helix 3, and a carboxyl-terminal Greek key beta-barrel domain..
Pfam Number: pfam00128 Score: 466 E_value: 4e-47
Swissprot: P00692|AMY_BACAM
Gene Ontology:
GO:0004556 = Molecular function: alpha-amylase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.016NO0.052NO0.020NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0910.0560.915_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.01607First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00004257001
MRELIGAPGNDPKTPTPENPTMFQGFEWHTPADQHHWDRLAGAVPKLKEI
GITALWIPPACKAGNPSSNGYDIYDLYDLGEFDHKWSRPTKWGHKESLIR
LRDTAKHHGIGLIFDAVLNHKANADYTERCRVVEVNPEDRNEVISEPYEI
DGWLYFDFATRGDRYSQMKYHWYHFSGTDYNQENQKTAIYKIIGDNEEKE
WCQYVDTSELGNYDYLMFANLDYSNPDVCNDVKNWGVWVTQELGLKGFRF
DAVRHFSLEFLKEFIDHLDKTLGEDWFFVGEYWKGYVEPLEKFLDEMDHR
FSLFDFPLLENIFMISNLPYADLRTIFDGALVERRPLNAVTFVTSHDTQS
GQDLERIIPDYFKPLAYALILLRAEGYPCVFFGDIYGIKGNDPSPPACSG
ALPSLVLARKLYAYGDQNDFFDDPNCIGWVRRGTHDRKDGCAVLMSNFGD
GEKRIDGDVKIGDDGWAKFRCYAMSVSVWVNKAAEGRDRFGDL

EST contigs matching with the Gene:

ContigBest BlastXE-value
SY0AAA37YF18FM1 hypothetical protein SNOG_01869 [Phaeosphaeria nodorum SN15]1e-36


Manual Annotation:

Please find below the necessary files for GSTUMT00004257001 annotation :

link to GSTUMT00004257001 Artemis file
link to scaffold_11 sequence file
link to scaffold_11ESTs