Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00001858001
Length(AA) : 863
Localization : scaffold_299
No EST evidence
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein FG05636.1
Specie: [Gibberella zeae PH-1]
Accession: ref|XP_385812.1| Score: 1069 E_value: 1e-114
KEGG Definition: hypothetical protein
Accession: fgr:FG05636.1 Score: 1069 E_value: 1e-114
KOG Definition: Histone deacetylase complex, catalytic component HDA1
Classification: [Chromatin structure and dynamics].
Kog Number: KOG1343 Score: 173 E_value: 8e-13
PFAM Definition: Hist_deacetyl, Histone deacetylase domain. Histones can be reversibly acetylated on several lysine residues. Regulation of transcription is caused in part by this mechanism. Histone deacetylases catalyse the removal of the acetyl group. Histone deacetylases are related to other proteins..
Pfam Number: pfam00850 Score: 334 E_value: 2e-31
Swissprot: Q02959|HOS3_YEAST
Gene Ontology:
GO:0005935 = Cellular component: cellular bud neck
GO:0005737 = Cellular component: cytoplasm
GO:0005634 = Cellular component: nucleus
GO:0004407 = Molecular function: histone deacetylase activity
GO:0016575 = Biological process: histone deacetylation

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.054NO0.138NO0.049NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.5280.0640.382M584

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=0.00038First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00001858001
MSAPTAVIFHDTSYRHRYSRPNTSLQDLATIVERPERIPAATLGVAAAQT
RVGRSRLSIRKSERMGSLLDLEVMLVHCHAAPVRGAKSSWPEDLAAMCGA
AAEKLKKGECEVPKGYHQGDLYLCEESKEDLEGCLGALYDGVDLVFGGDE
RNGTISEDDQKRRGVRRAFVCIRPPGKLISSQSQAHTNCQSIGHHCAETQ
PSGFCWLNNVHIAIAHAARAHGLSHAVILDFDLHHGDGSQAIAWTLNELA
ESTHNTSKRTSGIQVPNIGYFSLHDINSYPCEYGDIDKIKNASLNLHAHG
QCMQNVHLAPYSTEGEFWTLYNDKYSSLLTKAREFLSVAAVSKPKKSREF
KAGVFLSAGFDASEHEGAGMQRHAVNVPTSFFARFTSDAVALAEEYCHGR
VLSVLEGGYSDRALTTGVFAHMAGLACAPPEAASTYVSPSLGLTPLHKPL
ENSGLDRGWDAEWWGMERVLELEGHFAKMTAKKPNVERASTSYLSPTAAS
VAKKNDVPRRVMSNGYLDGNNNNGPPPPPPVIPWEVAAFDLSRMIVPEFR
ESVEIPPIEKPTKRSARHSVIGVVDPDGTRMTLRDRKPKPAPDPSPDIDR
GRRRMTTTGILPDSAASSRAPSRAVSRAPSRAPSKAPSRPPSRAQRVGAP
SRGVTPIPPSRGTTPAPGGRQIGSTSGGGVTVAGPRKAVVKKPSVIGTDV
SKRVVDQHPVTAVQKTSSTISSASSVASSSPTGSQEPMKTGCDDDVDSLT
KGMFKVKLTYKNRDKDRAEQLRILEQEKERTERALETEKRRLATNHALKR
KEGGVGRMKEAFERNLTGTTAAGSHAEKETKMVDNVEIPVACSPMDQTFH
GGDIKFADPWQGK
Please find below the necessary files for GSTUMT00001858001 annotation :

link to GSTUMT00001858001 Artemis file
link to scaffold_299 sequence file
link to scaffold_299ESTs