Tuber melanosporum DB

You are here: MycorWeb Genome resources Tuber melanosporum DB EST & Gene Sequences Gene card

Gene Name: GSTUMT00000322001
Length(AA) : 1119
Localization : scaffold_107
No EST evidence
                         
  User annotation : No user annotation

Blast Results:

Nr Definition: hypothetical protein CIMG_00042
Specie: [Coccidioides immitis RS]
Accession: ref|XP_001246271.1| Score: 2917 E_value: 0.0
KEGG Definition: hypothetical protein [EC:1.14.99.1]; K00509 prostaglandin-endoperoxide synthase
Accession: mgr:MGG_10859 Score: 2804 E_value: 0.0
KOG Definition: Peroxidase/oxygenase
Classification: [General function prediction only].
Kog Number: KOG2408 Score: 304 E_value: 7e-28
PFAM Definition: An_peroxidase, Animal haem peroxidase..
Pfam Number: pfam03098 Score: 319 E_value: 1e-29
Swissprot: Q9UUS2|LIDS_GAEGR
Gene Ontology:
GO:0033751 = Molecular function: linoleate diol synthase activity

SignalP

SignalP 3.0 predicts the presence and location of signal peptide cleavage sites in amino acid sequences.
The method incorporates a prediction of cleavage sites and a signal peptide/non-signal peptide prediction
based on a combination of several artificial neural networks and hidden Markov models.

Neural networkHMM
Smean scoreSmean predictionSmax scoreSmax predictionD-scoreD predictionHMM prediction
0.016NO0.038NO0.018NON

TargetP

TargetP 1.1 predicts the subcellular location of eukaryotic proteins. The location assignment is based on
the predicted presence of any of the N-terminal presequences: mitochondrial targeting peptide (mTP)
or secretory pathway signal peptide (SP).

Mitochondrion ScoreSecretory ScoreAny other locationLocalizationReliability classPredicted presenquence length
0.0810.0270.961_10

TMHMM

Prediction of transmembrane helices in proteins

ExpAA=2.66514First60=0PredHel=0
Topology=()

ExpAA: The expected number of amino acids intransmembrane helices.
First60: The expected number of amino acids in transmembrane helices in the first 60 amino acids of the protein.
PredHel: The number of predicted transmembrane helices by N-best.
Topology: The topology predicted by N-best.

Sequence:
>GSTUMT00000322001
MASNGDGTNGATNGDSKYATQSKPPPPVAKPTRAAVDSTFEQFSNLLHAS
NRPLPNRFGDGKDQRPPELKPTGVLTDINTLRRGGFFWESVGTLWDFLKQ
KAKGGAVDDKTMIMERVIQLTSRLPPTSKARVALTTLQVDQLWDSLQHPP
LSYLGDEFSYRQADGGYNNIMYPQLGRAGSAYARSVKPMTKMPGAPPDAY
TLFDRIFSRGPNDEHFREHDNNVSSMLFYTATIIIHDLFRTNRENQNISD
TSSYLDLAPLYGSSVEDQSKIRTFQDGKIKPDSYSEKRLLAFPPGVSVLL
IMFGRFHNYVVENLKAINEGGRFNLKFPRYPNGDDEVTRQAKALRQQDED
LFQTGRLVTCGLYINFILNDYLRTIVNLNRVDTTWTLDPRFEASKVYNPD
GTPAGIGNMVSAEFNLIYRWHSCISKRDDQWTKDFYQGLFPGRDASDIEM
PEFTRGVGRWERSLSDDPIQRNIAGLERKADGSYHDDDLVKILTESVEDV
AGAFGARNVPHVLRLVEVLGIEQSRKWMVGSLNELREFFGLKPHATFEDI
NPDPAVANTLRQLYDHPDFVEMYAGLVAEADKKPMVPGVGIGPTYTISRA
ILSDAVTLVRGDRFYTADYTASHLTNWGLQEASSDLATVYGCVGYKLILK
AFPNHFKFNSIYAHYPLTIPQENHKIHTALNSVDQFDFERPVYTPPRIPI
SSYNATKQILCDAENFKVTWGAGFDFIMRADFMLSGDKPSNSEQKQFVRD
RLYLGGVDWKQQIRQFYEEATEKLIRKKAYSLGDTYQVDAVRDIGNIAQT
IFAASIFNLPMKSEDHPKGIYTEQELYMILCVMFIVIFFDIDSSKSFPLR
QAGFKVVRQYGTLVEAQVKAIKNWSWLQGVWDPLNIRGRNKSSPLKSYGW
TMIKRLLDTGKSPYDVTWSYIVPTAGASAPNQGQIFAQVLDFYLEDRNSH
HLAEIQRLAQSGAVDAWETIKKYALEGGRLAGTFGLYRRVEPDNITIEDN
GRNIELRKGDMVFVNFITASRDPVVFPDPLEIKLDRPEASYMQYGDGPHE
CLGKAANIIGLTTMLMQFGKLKGLRRAPGPQGALKYIPKPGGFKVYMKED
WSAYWPFPTSMKVRFDDII
Please find below the necessary files for GSTUMT00000322001 annotation :

link to GSTUMT00000322001 Artemis file
link to scaffold_107 sequence file
link to scaffold_107ESTs